Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hexokinase-1 (HK1), partial

This Recombinant Human Hexokinase-1 (HK1), partial spans the amino acid sequence from region 476-917aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain form hexokinaseHexokinase type I , HK I

UniProt

P19367

Expression Region

476-917aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 (ATP-binding Cassette Sub-family G Member 2, MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, GOUT1, CDw338, UAQTL1, EST157481) (MaxLight 405)
MBS6405040-01 0.1 mL

ABCG2 (ATP-binding Cassette Sub-family G Member 2, MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, GOUT1, CDw338, UAQTL1, EST157481) (MaxLight 405)

Sign In for Pricing
View Details
ABCG2 (ATP-binding Cassette Sub-family G Member 2, MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, GOUT1, CDw338, UAQTL1, EST157481) (MaxLight 405)
MBS6405040-02 5x 0.1 mL

ABCG2 (ATP-binding Cassette Sub-family G Member 2, MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, GOUT1, CDw338, UAQTL1, EST157481) (MaxLight 405)

Sign In for Pricing
View Details
Gigaxonin Polyclonal Antibody, FITC Conjugated
bs-11025R-FITC 100 µL

Gigaxonin Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NUDT18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1466306 1.0 µg DNA

NUDT18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse VE-Cadherin/CD144 ELISA Kit
orb1657868 96 Tests

Mouse VE-Cadherin/CD144 ELISA Kit

Sign In for Pricing
View Details
Rat Ubl7 Pre-designed siRNA Set A
SI215544A 1 Each

Rat Ubl7 Pre-designed siRNA Set A

Sign In for Pricing
View Details