Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial

This Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial spans the amino acid sequence from region 165-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-dependent inwardly rectifying potassium channel Kir4.1Inward rectifier K (+) channel Kir1.2, Potassium channel, inwardly rectifying subfamily J member 10

UniProt

P78508

Expression Region

165-379aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV1-33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1051706 1.0 µg DNA

IGKV1-33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody
CAU32928-01 100 µL

Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody

Sign In for Pricing
View Details
Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody
CAU32928-02 200 µL

Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody

Sign In for Pricing
View Details
Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody
CAU32928-03 1 mL

Prothrombin Fragment 1+2 (F1+2) Monoclonal Antibody

Sign In for Pricing
View Details
Human DOK7/Protein Dok-7 ELISA Kit
MBS2906635-01 48 Well

Human DOK7/Protein Dok-7 ELISA Kit

Sign In for Pricing
View Details
Human DOK7/Protein Dok-7 ELISA Kit
MBS2906635-02 96 Well

Human DOK7/Protein Dok-7 ELISA Kit

Sign In for Pricing
View Details