Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anas platyrhynchos Lysozyme C-1

This Recombinant Anas platyrhynchos Lysozyme C-1 spans the amino acid sequence from region 19-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-beta-N-acetylmuramidase C

UniProt

P00705

Expression Region

19-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Anas platyrhynchos (Mallard) (Anas boschas)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Antibody
abx421138-01 50 µg

Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Antibody
abx421138-02 100 µg

Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Antibody

Sign In for Pricing
View Details
Mouse TGF beta Receptor 2 protein
orb707289-01 10 µg

Mouse TGF beta Receptor 2 protein

Sign In for Pricing
View Details
Mouse TGF beta Receptor 2 protein
orb707289-02 50 µg

Mouse TGF beta Receptor 2 protein

Sign In for Pricing
View Details
Mouse TGF beta Receptor 2 protein
orb707289-03 500 µg

Mouse TGF beta Receptor 2 protein

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1355919-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details