Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)

This Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) spans the amino acid sequence from region 1-309aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PP2A beta, PP2A-beta, PP2AB_HUMAN, PP2Abeta, PP2CB, Ppp2cb, Protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform, Protein phosphatase 2 catalytic subunit beta isozyme, Protein phosphatase 2, catalytic subunit, beta isoform, Protein phosphatase 2A catalytic subunit beta isoform, Protein phosphatase type 2A catalytic subunit, Serine/threonine protein phosphatase 2A catalytic subunit beta, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

UniProt

P62714

Expression Region

1-309aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD2 Antibody (RPA-2.10) [PerCP]
NBP2-25200PCP 0.1 mL

Mouse Monoclonal CD2 Antibody (RPA-2.10) [PerCP]

Sign In for Pricing
View Details
Mouse Monoclonal NDUFB9 Antibody (OTI8B7)
NBP2-00495 0.1 mL

Mouse Monoclonal NDUFB9 Antibody (OTI8B7)

Sign In for Pricing
View Details
Bis-PEG2-amine-Thalidomide (hydrochloride)
orb3176319-01 10 mg

Bis-PEG2-amine-Thalidomide (hydrochloride)

Sign In for Pricing
View Details
Bis-PEG2-amine-Thalidomide (hydrochloride)
orb3176319-02 50 mg

Bis-PEG2-amine-Thalidomide (hydrochloride)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Ribosome maturation factor RimP (rimP)
MBS1052468-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Ribosome maturation factor RimP (rimP)
MBS1052468-02 0.1 mg (E-Coli)

Recombinant Mycobacterium bovis Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details