Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial

This Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial spans the amino acid sequence from region 1-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arp2/3 complex 34KDA subunit , p34-AR, C

UniProt

O15144

Expression Region

1-250aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit LPAP Antibody
orb1522967-01 10 µL

Rabbit LPAP Antibody

Sign In for Pricing
View Details
Rabbit LPAP Antibody
orb1522967-02 100 µL

Rabbit LPAP Antibody

Sign In for Pricing
View Details
SHANK1 (SH3 and Multiple Ankyrin Repeat Domains 1, SPANK-1, SSTRIP, synamon) (FITC)
251643-FITC 100 µL

SHANK1 (SH3 and Multiple Ankyrin Repeat Domains 1, SPANK-1, SSTRIP, synamon) (FITC)

Sign In for Pricing
View Details
Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)
ARP6019-01 10 µg

Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)
ARP6019-02 50 µg

Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)
ARP6019-03 100 µg

Recombinant Human Estrogen Receptor α/ERα/NR3A1 Protein (N-6His)

Sign In for Pricing
View Details