Recombinant Human C-C motif chemokine 5 (CCL5)
Selected Variant
GTR18894196-01
Size: 20 µg
This Recombinant Human C-C motif chemokine 5 (CCL5) spans the amino acid sequence from region 24-91aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
EoCPEosinophil chemotactic cytokine, SIS-delta, Small-inducible cytokine A5T cell-specific protein P228 , TCP228T-cell-specific protein RANTES
UniProt
P13501
Expression Region
24-91aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A10232-1-APC 100 µg/Vial
Anti-GLIPR2 Antibody Picoband®, APC Conjugate
Sign In for Pricing
View Details 
BNC882868-500 1x 500 µL
Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
EK0919 96 Well With Removable Strips
Mouse CXCL5 / LIX / ENA-78 / GCP 2 ELISA Kit PicoKine®
Sign In for Pricing
View Details 
PB9557-PE 100 µg/Vial
Anti-SP2 transcription factor Antibody Picoband® (PE Conjugate)
Sign In for Pricing
View Details