Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 5 (CCL5)

This Recombinant Human C-C motif chemokine 5 (CCL5) spans the amino acid sequence from region 24-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EoCPEosinophil chemotactic cytokine, SIS-delta, Small-inducible cytokine A5T cell-specific protein P228 , TCP228T-cell-specific protein RANTES

UniProt

P13501

Expression Region

24-91aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REM (REM1) Rabbit Polyclonal Antibody
TA368107 100 µL

REM (REM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2-Chloroethyl)(3-chloropropyl)amine Hydrochloride
TRC-C364930-1G 1 g

(2-Chloroethyl)(3-chloropropyl)amine Hydrochloride

Sign In for Pricing
View Details
4-[2-(1-Piperidinyl)ethoxy]benzoic Acid Hydrochloride Salt
TRC-P482025-250MG 250 mg

4-[2-(1-Piperidinyl)ethoxy]benzoic Acid Hydrochloride Salt

Sign In for Pricing
View Details
PTCH1 Rabbit Polyclonal Antibody
TA372983 100 µL

PTCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC theta (PRKCQ) pSer676 Rabbit Polyclonal Antibody
AP02534PU-S 50 µL

PKC theta (PRKCQ) pSer676 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant RPA2 (phospho T21) Antibody
RC-15281-01 50 μL

Recombinant RPA2 (phospho T21) Antibody

Sign In for Pricing
View Details