Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interstitial collagenase (MMP1), partial

This Recombinant Human Interstitial collagenase (MMP1), partial spans the amino acid sequence from region 101-469aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast collagenase, Matrix metalloproteinase-1 , MMP-1

UniProt

P03956

Expression Region

101-469aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Guaifenesin-d5 Cyclic Carbonate
TRC-G810517-1MG 1 mg

rac Guaifenesin-d5 Cyclic Carbonate

Sign In for Pricing
View Details
Recombinant GDF-3 Monoclonal Antibody
AN300294P-01 20 µL

Recombinant GDF-3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GDF-3 Monoclonal Antibody
AN300294P-02 100 µL

Recombinant GDF-3 Monoclonal Antibody

Sign In for Pricing
View Details
3-Amino-1,2,4-triazole (Amitrole)
TRC-A633380-10G 10 g

3-Amino-1,2,4-triazole (Amitrole)

Sign In for Pricing
View Details
CLP Recombinant Rabbit monoclonal Antibody
HA750748 100 µL

CLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
PDEM100156-01 20 µg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details