Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Advanced glycosylation end product-specific receptor (AGER), partial

This Recombinant Human Advanced glycosylation end product-specific receptor (AGER), partial spans the amino acid sequence from region 23-342aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor for advanced glycosylation end products

UniProt

Q15109

Expression Region

23-342aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM4, ID (LSM4, U6 snRNA-associated Sm-like protein LSm4, Glycine-rich protein) (MaxLight 650)
MBS6317491-01 0.1 mL

LSM4, ID (LSM4, U6 snRNA-associated Sm-like protein LSm4, Glycine-rich protein) (MaxLight 650)

Sign In for Pricing
View Details
LSM4, ID (LSM4, U6 snRNA-associated Sm-like protein LSm4, Glycine-rich protein) (MaxLight 650)
MBS6317491-02 5x 0.1 mL

LSM4, ID (LSM4, U6 snRNA-associated Sm-like protein LSm4, Glycine-rich protein) (MaxLight 650)

Sign In for Pricing
View Details
E330014E10Rik Double Nickase Plasmid (m2)
sc-437085-NIC-2 20 µg

E330014E10Rik Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Egr4 siRNA Oligos set (Mouse)
19048174 3x 5 nmol

Egr4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
1-Boc-3-Bromoindole
sc-258650A 5 g

1-Boc-3-Bromoindole

Sign In for Pricing
View Details
Ly86 (NM_010745) Mouse Tagged ORF Clone
MR201281 10 µg

Ly86 (NM_010745) Mouse Tagged ORF Clone

Sign In for Pricing
View Details