Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea Pig Interferon gamma (Ifng), partial

This Recombinant Guinea Pig Interferon gamma (Ifng), partial spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8CGS0

Expression Region

24-166aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cavia porcellus (Guinea pig)

Field of Research

Infectious Disease & Virology; Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIVSFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQISVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), 0.2mg/mL
BNUB2848-100 1x 100 µL

Fibronectin (Fn-3), 0.2mg/mL

Sign In for Pricing
View Details
TMEM9 (NM_001288565) Human Tagged ORF Clone
RG236355 10 µg

TMEM9 (NM_001288565) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS702183 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Ubiquitin (UBB) (NM_018955) Human Recombinant Protein
TP760992 50 µg

Ubiquitin (UBB) (NM_018955) Human Recombinant Protein

Sign In for Pricing
View Details
FLAP Recombinant Rabbit Monoclonal Antibody [JE39-03]
HA722341 100 µL

FLAP Recombinant Rabbit Monoclonal Antibody [JE39-03]

Sign In for Pricing
View Details
2-Hydrazinyl-9H-purin-6-amine
TRC-H625573-10MG 10 mg

2-Hydrazinyl-9H-purin-6-amine

Sign In for Pricing
View Details