Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea Pig Interferon gamma (Ifng), partial

This Recombinant Guinea Pig Interferon gamma (Ifng), partial spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8CGS0

Expression Region

24-166aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cavia porcellus (Guinea pig)

Field of Research

Infectious Disease & Virology; Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIVSFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQISVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRAPPC6A activation kit by CRISPRa
GA112362 1 Kit

Human TRAPPC6A activation kit by CRISPRa

Sign In for Pricing
View Details
(Tosyl-d7)urethane
TRC-T686903-50MG 50 mg

(Tosyl-d7)urethane

Sign In for Pricing
View Details
Tonsl Mouse Gene Knockout Kit (CRISPR)
KN518056 1 Kit

Tonsl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MFluor™ Violet 540 Anti-human CD3 Antibody *UCHT1*
10032120-AAT 100 Tests

MFluor™ Violet 540 Anti-human CD3 Antibody *UCHT1*

Sign In for Pricing
View Details
Human B3GNTL1 activation kit by CRISPRa
GA115572 1 Kit

Human B3GNTL1 activation kit by CRISPRa

Sign In for Pricing
View Details
EWSR1 (NM_005243) Human Over-expression Lysate
LC401610 20 µg

EWSR1 (NM_005243) Human Over-expression Lysate

Sign In for Pricing
View Details