Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen triple helix repeat-containing protein 1 (CTHRC1), partial

This Recombinant Human Collagen triple helix repeat-containing protein 1 (CTHRC1), partial spans the amino acid sequence from region 31-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96CG8

Expression Region

31-243aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2B type 1B [ac Lys20] Antibody (RM235) [Janelia Fluor 646]
NBP3-26027JF646 0.1 mL

Rabbit Monoclonal Histone H2B type 1B [ac Lys20] Antibody (RM235) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse Monoclonal Natural Killer Cell Antibody (H25) [CoraFluor 1]
NBP2-50526CL1 0.1 mL

Mouse Monoclonal Natural Killer Cell Antibody (H25) [CoraFluor 1]

Sign In for Pricing
View Details
HERPUD1 (homocysteine-Inducible, Endoplasmic Reticulum Stress-Inducible, Ubiquitin-like Domain Member 1, HERP, KIAA0025, Mif1, SUP) (MaxLight 550)
247009-ML550 100 µL

HERPUD1 (homocysteine-Inducible, Endoplasmic Reticulum Stress-Inducible, Ubiquitin-like Domain Member 1, HERP, KIAA0025, Mif1, SUP) (MaxLight 550)

Sign In for Pricing
View Details
GABBR2 siRNA Oligos set (Human)
21146171 3x 5 nmol

GABBR2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human TTC24 shRNA Plasmid
abx966006-01 150 µg

Human TTC24 shRNA Plasmid

Sign In for Pricing
View Details
Human TTC24 shRNA Plasmid
abx966006-02 300 µg

Human TTC24 shRNA Plasmid

Sign In for Pricing
View Details