Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

This Recombinant Rat Alpha-1-acid glycoprotein (Orm1) spans the amino acid sequence from region 19-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Orosomucoid (OMD)

UniProt

P02764

Expression Region

19-205aa

Tag

Tag-Free

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTTP Protein Vector (Mouse) (pPM-C-His)
PV202937 500 ng

MTTP Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)
orb2934115-01 20 µg

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

Sign In for Pricing
View Details
Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)
orb2934115-02 100 µg

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

Sign In for Pricing
View Details
NCOA5 Polyclonal Antibody
MBS9236944-01 0.1 mL

NCOA5 Polyclonal Antibody

Sign In for Pricing
View Details
NCOA5 Polyclonal Antibody
MBS9236944-02 5x 0.1 mL

NCOA5 Polyclonal Antibody

Sign In for Pricing
View Details
STAG3L4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2298707 1.0 µg DNA

STAG3L4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details