Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF)

This Recombinant Human Brain-derived neurotrophic factor (BDNF) spans the amino acid sequence from region 19-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Abrineurin (ProBDNF)

UniProt

P23560

Expression Region

19-247aa

Tag

N-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map2K1 Recombinant Antibody
RAC07510-01 50 µL

Map2K1 Recombinant Antibody

Sign In for Pricing
View Details
Map2K1 Recombinant Antibody
RAC07510-02 100 µL

Map2K1 Recombinant Antibody

Sign In for Pricing
View Details
CCDC124 siRNA (m)
sc-142068 10 µM

CCDC124 siRNA (m)

Sign In for Pricing
View Details
Recombinant Human LAIR1 His-tag Avi-tag Protein CF
AVI2664-050 50 µg

Recombinant Human LAIR1 His-tag Avi-tag Protein CF

Sign In for Pricing
View Details
Pixantrone Maleate Impurity C
RM-P242003-01 10 mg

Pixantrone Maleate Impurity C

Sign In for Pricing
View Details
Pixantrone Maleate Impurity C
RM-P242003-02 25 mg

Pixantrone Maleate Impurity C

Sign In for Pricing
View Details