Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 3 (hmw3), partial

This Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 3 (hmw3), partial spans the amino acid sequence from region 160-339aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Accessory adhesin protein 3 (Cytadherence accessory protein 3)

UniProt

Q50360

Expression Region

160-339aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORF E7 (NC_001354) Virus Tagged ORF Clone
VC101933 10 µg

ORF E7 (NC_001354) Virus Tagged ORF Clone

Sign In for Pricing
View Details
RGD1305014 Recombinant Protein (Rat)
RP224303 100 µg

RGD1305014 Recombinant Protein (Rat)

Sign In for Pricing
View Details
DS07551382
HY-177450 1 Each

DS07551382

Sign In for Pricing
View Details
RASD2 Antibody
CSB-PA249540-01 50 μL

RASD2 Antibody

Sign In for Pricing
View Details
RASD2 Antibody
CSB-PA249540-02 100 µL

RASD2 Antibody

Sign In for Pricing
View Details
FLIP Rabbit Polyclonal Antibody (HRP)
orb482850 100 µL

FLIP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details