Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev)

This Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev) spans the amino acid sequence from region 1-107aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ART/TRS (Anti-repression transactivator) (Regulator of expression of viral proteins)

UniProt

Q75006

Expression Region

1-107aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) (HIV-1)

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Human IgG3 (IB3) Isotype Control
ICH2256-25mg 25 mg

Bulk Human IgG3 (IB3) Isotype Control

Sign In for Pricing
View Details
Canine Very Late Appearing antigen-4 (VLA-4) ELISA Kit
EIA06524Ca 1 Kit

Canine Very Late Appearing antigen-4 (VLA-4) ELISA Kit

Sign In for Pricing
View Details
Legumain Rabbit Polyclonal Antibody (BF647)
orb1582707 100 µL

Legumain Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Anti-Phospho-c-Jun/JUN (S243) Antibody
P02038-3 100 µL

Anti-Phospho-c-Jun/JUN (S243) Antibody

Sign In for Pricing
View Details
Chicken TATA Box Binding Protein ELISA kit
GTR10372855 96 Well

Chicken TATA Box Binding Protein ELISA kit

Sign In for Pricing
View Details
Fibulin 3 (FBLN3) Monoclonal Antibody
CAU30515-01 100 µL

Fibulin 3 (FBLN3) Monoclonal Antibody

Sign In for Pricing
View Details