Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Anterior gradient protein 2 homolog (Agr2)

This Recombinant Mouse Anterior gradient protein 2 homolog (Agr2) spans the amino acid sequence from region 21-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Gob-4 (Secreted cement gland protein XAG-2 homolog)

UniProt

O88312

Expression Region

21-175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK32C Rabbit Polyclonal Antibody
APRab18394-01 20 µL

STK32C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK32C Rabbit Polyclonal Antibody
APRab18394-02 50 µL

STK32C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK32C Rabbit Polyclonal Antibody
APRab18394-03 100 µL

STK32C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK32C Rabbit Polyclonal Antibody
APRab18394-04 200 µL

STK32C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse-derived Nucleic Acid Detection Kit (Fluorescence PCR)
BSB50S1 24 Tests

Mouse-derived Nucleic Acid Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
Anserini MHB ELISA Kit
EAM0278 96 Tests

Anserini MHB ELISA Kit

Sign In for Pricing
View Details