Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 40S ribosomal protein S3 (RPS3)

This Recombinant Human 40S ribosomal protein S3 (RPS3) spans the amino acid sequence from region 2-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ribosomal subunit protein uS3

UniProt

P23396

Expression Region

2-243aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnase11 Rat siRNA Oligo Duplex (Locus ID 497651)
SR505251 1 Kit

Rnase11 Rat siRNA Oligo Duplex (Locus ID 497651)

Sign In for Pricing
View Details
Rabbit Polyclonal Synaptobrevin homolog YKT6 Antibody
NBP2-94847-0.1mL 0.1 mL

Rabbit Polyclonal Synaptobrevin homolog YKT6 Antibody

Sign In for Pricing
View Details
Ntf3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4416504 1.0 µg DNA

Ntf3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TRNAT18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48411061 1.0 µg DNA

TRNAT18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Gliomedin shRNA (m) Lentiviral Particles
sc-62379-V 200 µL

Gliomedin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Atp9a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4768307 1.0 µg DNA

Atp9a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details