Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp)

This Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) spans the amino acid sequence from region 29-149aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHIPS

UniProt

Q6GFB3

Expression Region

29-149aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR3 (NM_002030) Human Tagged Lenti ORF Clone
RC209257L4 10 µg

FPR3 (NM_002030) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BTK siRNA (Human)
CRH0483-01 15 nmol

BTK siRNA (Human)

Sign In for Pricing
View Details
BTK siRNA (Human)
CRH0483-02 30 nmol

BTK siRNA (Human)

Sign In for Pricing
View Details
ZN735 rabbit pAb
UB-GEN-8160 100 µL

ZN735 rabbit pAb

Sign In for Pricing
View Details
Olfr846 AAV Vector (Mouse) (CMV)
33489104 1 µg

Olfr846 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
IL1F10 Monoclonal Antibody
A10550-100UG 100 µg

IL1F10 Monoclonal Antibody

Sign In for Pricing
View Details