Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cornifin-A (SPRR1A)

This Recombinant Human Cornifin-A (SPRR1A) spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

19 kDa pancornulin (SPRK) (Small proline-rich protein IA) (SPR-IA)

UniProt

P35321

Expression Region

1-89aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Peripheral nerve
CS515470 5x 5 µm

Frozen Tissue Sections, Peripheral nerve

Sign In for Pricing
View Details
Factor XIIIa (F13A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G12]
TA800370BM 100 µL

Factor XIIIa (F13A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G12]

Sign In for Pricing
View Details
Aquaporin 7 (AQP7) Human Gene Knockout Kit (CRISPR)
KN212363RB 1 Kit

Aquaporin 7 (AQP7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561454 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein
TP325196L 1 mg

MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein

Sign In for Pricing
View Details
Pathology Workstation BAIP-302
BAIP-302 1 Unit

Pathology Workstation BAIP-302

Sign In for Pricing
View Details