Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cornifin-A (SPRR1A)

This Recombinant Human Cornifin-A (SPRR1A) spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

19 kDa pancornulin (SPRK) (Small proline-rich protein IA) (SPR-IA)

UniProt

P35321

Expression Region

1-89aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFRS12 (SREK1) (NM_001077199) Human Over-expression Lysate
LY421381 100 µg

SFRS12 (SREK1) (NM_001077199) Human Over-expression Lysate

Sign In for Pricing
View Details
Impurity F: (Diol Imp.)1,1’-bis(carbethoxy)-4,4’-dihydroxy-4,4’bipiperidine
TRC-I172770-250MG 250 mg

Impurity F: (Diol Imp.)1,1’-bis(carbethoxy)-4,4’-dihydroxy-4,4’bipiperidine

Sign In for Pricing
View Details
Pygo2 Mouse Gene Knockout Kit (CRISPR)
KN514293 1 Kit

Pygo2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC-AstralTM813 Conjugate, 0.1 mg/mL
BNC131331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC-AstralTM813 Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF488A conjugate, 0.1mg/mL
BNC880979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details