Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Inner membrane protein p54, partial

This Recombinant African swine fever virus Inner membrane protein p54, partial spans the amino acid sequence from region 73-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q65272

Expression Region

73-160aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

African swine fever virus (isolate Pig/Portugal/Lis 60/1960) (ASFV)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Antibody
B7247-01 50 µL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
B7247-02 100 µL

Tau Antibody

Sign In for Pricing
View Details
Gm14391 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3182702 1.0 µg DNA

Gm14391 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Cadherin-6 (CDH6) Human ELISA Kit
C0321 96 Tests

Cadherin-6 (CDH6) Human ELISA Kit

Sign In for Pricing
View Details
Guinea pig Ascorbate Peroxidase (APX) ELISA Kit
EIA07471Gu 1 Kit

Guinea pig Ascorbate Peroxidase (APX) ELISA Kit

Sign In for Pricing
View Details
Human CD27 Pre-designed siRNA Set A
SI002553A 1 Each

Human CD27 Pre-designed siRNA Set A

Sign In for Pricing
View Details