Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

This Recombinant Human Delta-like protein 3 (DLL3), partial spans the amino acid sequence from region 383-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Drosophila Delta homolog 3 (Delta3)

UniProt

Q9NYJ7

Expression Region

383-492aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human TMEM123 (Transmembrane protein 123) Full Length
MPC1439K Each

Magic™ Membrane Protein Human TMEM123 (Transmembrane protein 123) Full Length

Sign In for Pricing
View Details
LECT2 Human
OM305008-01 2 µg

LECT2 Human

Sign In for Pricing
View Details
LECT2 Human
OM305008-02 10 µg

LECT2 Human

Sign In for Pricing
View Details
LECT2 Human
OM305008-03 1 mg

LECT2 Human

Sign In for Pricing
View Details
Codfish (f3)
ED7715 25 Tests

Codfish (f3)

Sign In for Pricing
View Details
Camel Cyclin A1 ELISA Kit
MBS082772-01 48 Well

Camel Cyclin A1 ELISA Kit

Sign In for Pricing
View Details