Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65)

This Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65) spans the amino acid sequence from region 1-405aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0CJ81

Expression Region

1-405aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDINKPGWNQSDQQATAYDPNQQQYYGDGSTYYDPDQAVDPNQAYYPDPNTYPDAAAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPNAYVDPNAYQDPNAYVDPNNYTDPNAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPYYVTSTDPNAYYGQVDNVPALEASDLAYEVTPQEQAAEQELFSEPETKVIREIHEFPFEKIRSYFQTDFDSYNSRLTQLKDKLDNAIFSMRKAIDTVKENSANLQIMKQNFERQLKEQQTQRLTSNTDAEKIGAKINQLEERMQRLSRTMESVEWTKKEPRQEQFDPRFVDPRNFNNYVNNTDTMMSMFEKVLMMNLLRSTTPVQPPVQYFTPQPLTASPRPVYEEPISASFRRRGYRGDEFYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Human IL6R protein, His-tagged
IL6R-786H 50 µg

Active Recombinant Human IL6R protein, His-tagged

Sign In for Pricing
View Details
VN1R103P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV789742 1.0 µg DNA

VN1R103P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
4921530L21Rik Protein Vector (Mouse) (pPB-N-His)
PV148967 500 ng

4921530L21Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Phalloidin Conjugated Dye 430
S01YF-0223-KX354 1 Vial

Phalloidin Conjugated Dye 430

Sign In for Pricing
View Details
Histone H2A, phosphorylated (T121) discontinued
341468-01 100 µL

Histone H2A, phosphorylated (T121) discontinued

Sign In for Pricing
View Details
Histone H2A, phosphorylated (T121) discontinued
341468-02 200 µL

Histone H2A, phosphorylated (T121) discontinued

Sign In for Pricing
View Details