Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5)

This Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) spans the amino acid sequence from region 25-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thyrostimulin subunit beta

UniProt

Q812B2

Expression Region

25-130aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha Synuclein (SNCA) pTyr125 Rabbit Polyclonal Antibody
AP09463PU-S 50 µL

alpha Synuclein (SNCA) pTyr125 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]
TA506886BM 100 µL

SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF568 conjugate, 0.1mg/mL
BNC683086-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Over-expression Lysate
LY402056 100 µg

Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Over-expression Lysate

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-01 20 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-02 60 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details