Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10)

This Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10) spans the amino acid sequence from region 29-151aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Group X secretory phospholipase A2 (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)

UniProt

Q9QXX3

Expression Region

29-151aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MCM7 Antibody (MCM7/1468) [Alexa Fluor 405]
NBP2-59611AF405 100 µL

Mouse Monoclonal MCM7 Antibody (MCM7/1468) [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Human Syndecan-1 Fc Chimera Avi-tag Protein CF
AVI10913-050 50 µg

Recombinant Human Syndecan-1 Fc Chimera Avi-tag Protein CF

Sign In for Pricing
View Details
HS2ST1 Antibody (N-term) Blocking Peptide
MBS9227111-01 0.5 mg

HS2ST1 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
HS2ST1 Antibody (N-term) Blocking Peptide
MBS9227111-02 5x 0.5 mg

HS2ST1 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
TYMP Rabbit Polyclonal Antibody (FITC)
orb2081778 100 µL

TYMP Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mitochondria (Marker for Human Cells) ; Clone AE-1 (Concentrate)
RA0396-C.5 0.5 mL

Mitochondria (Marker for Human Cells) ; Clone AE-1 (Concentrate)

Sign In for Pricing
View Details