Recombinant Human Myocardin-related transcription factor A (MRTFA), partial
This Recombinant Human Myocardin-related transcription factor A (MRTFA), partial spans the amino acid sequence from region 400-500aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MKL/myocardin-like protein 1 (Megakaryoblastic leukemia 1 protein) (Megakaryocytic acute leukemia protein)
UniProt
Q969V6
Expression Region
400-500aa
Tag
N-terminal 6xHis-KSI-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research; Musculoskeletal & Connective Tissue Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
APR11277G 0.1mg
Monoclonal NR1D1 Antibody (monoclonal) (M02), Clone: 4F6
Sign In for Pricing
View Details