Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgi phosphoprotein 3 (GOLPH3)

This Recombinant Human Golgi phosphoprotein 3 (GOLPH3) spans the amino acid sequence from region 1-298aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coat protein GPP34 (Mitochondrial DNA absence factor) (MIDAS)

UniProt

Q9H4A6

Expression Region

1-298aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DAZ1 Antibody [mFluor Violet 610 SE]
NBP2-98991MFV610 0.1 mL

Rabbit Polyclonal DAZ1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (PE)
MBS6365699-01 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (PE)

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (PE)
MBS6365699-02 5x 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (PE)

Sign In for Pricing
View Details
LASP-1 Polyclonal Antibody
BT-AP04955-01 20 µL

LASP-1 Polyclonal Antibody

Sign In for Pricing
View Details
LASP-1 Polyclonal Antibody
BT-AP04955-02 50 µL

LASP-1 Polyclonal Antibody

Sign In for Pricing
View Details
LASP-1 Polyclonal Antibody
BT-AP04955-03 100 µL

LASP-1 Polyclonal Antibody

Sign In for Pricing
View Details