Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterovirus A71 Genome polyprotein, partial

This Recombinant Enterovirus A71 Genome polyprotein, partial spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3D polymerase (3Dpol) (Protein 3D) (3D)

UniProt

F6KTB0

Expression Region

1441-1497aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Enterovirus A71

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADP-ribosylation factor 4, ARF4 ELISA Kit
MBS9325528-01 48 Well

Human ADP-ribosylation factor 4, ARF4 ELISA Kit

Sign In for Pricing
View Details
Human ADP-ribosylation factor 4, ARF4 ELISA Kit
MBS9325528-02 96 Well

Human ADP-ribosylation factor 4, ARF4 ELISA Kit

Sign In for Pricing
View Details
Human ADP-ribosylation factor 4, ARF4 ELISA Kit
MBS9325528-03 5x 96 Well

Human ADP-ribosylation factor 4, ARF4 ELISA Kit

Sign In for Pricing
View Details
Human ADP-ribosylation factor 4, ARF4 ELISA Kit
MBS9325528-04 10x 96 Well

Human ADP-ribosylation factor 4, ARF4 ELISA Kit

Sign In for Pricing
View Details
Msh5 (NM_212536) Rat Tagged ORF Clone
RR203842 10 µg

Msh5 (NM_212536) Rat Tagged ORF Clone

Sign In for Pricing
View Details
6-Chlorothiazolo[4,5-b]pyridin-2-amine
OR1041649-01 50 mg

6-Chlorothiazolo[4,5-b]pyridin-2-amine

Sign In for Pricing
View Details