Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Blood group Rh (CE) polypeptide (RHCE), partial

This Recombinant Human Blood group Rh (CE) polypeptide (RHCE), partial spans the amino acid sequence from region 379-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rh polypeptide 1 (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens)

UniProt

P18577

Expression Region

379-417aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIG1 Antibody
A76348-100UL 100 µL

LIG1 Antibody

Sign In for Pricing
View Details
ZMYND10, CT (ZMYND10, BLU, Zinc finger MYND domain-containing protein 10, Protein BLu) (MaxLight 405) discontinued
044100-ML405 100 µL

ZMYND10, CT (ZMYND10, BLU, Zinc finger MYND domain-containing protein 10, Protein BLu) (MaxLight 405) discontinued

Sign In for Pricing
View Details
2,2,4-trimethyl-1,2,3,4-tetrahydroquinoline
sc-343344 1 g

2,2,4-trimethyl-1,2,3,4-tetrahydroquinoline

Sign In for Pricing
View Details
Recombinant Mouse Importin-5 (Ipo5) , partial
MBS1381947-01 0.05 mg (E-Coli)

Recombinant Mouse Importin-5 (Ipo5) , partial

Sign In for Pricing
View Details
Recombinant Mouse Importin-5 (Ipo5) , partial
MBS1381947-02 0.05 mg (Yeast)

Recombinant Mouse Importin-5 (Ipo5) , partial

Sign In for Pricing
View Details
Recombinant Mouse Importin-5 (Ipo5) , partial
MBS1381947-03 0.2 mg (E-Coli)

Recombinant Mouse Importin-5 (Ipo5) , partial

Sign In for Pricing
View Details