Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Bone morphogenetic protein 4 (BMP4)

This Recombinant Bovine Bone morphogenetic protein 4 (BMP4) spans the amino acid sequence from region 294-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q2KJH1

Expression Region

294-409aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 650)
MBS6315005-01 0.1 mL

L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 650)

Sign In for Pricing
View Details
L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 650)
MBS6315005-02 5x 0.1 mL

L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 650)

Sign In for Pricing
View Details
Human Claudin 2 (CLDN2) (NM_020384) AAV Particle
RC204199A1V 250 µL

Human Claudin 2 (CLDN2) (NM_020384) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal ATG5 Antibody (ATG5/2553) [DyLight 488]
NBP3-08434G 100 µL

Mouse Monoclonal ATG5 Antibody (ATG5/2553) [DyLight 488]

Sign In for Pricing
View Details
CYC065
MBS3844957-01 1 mg

CYC065

Sign In for Pricing
View Details
CYC065
MBS3844957-02 5 mg

CYC065

Sign In for Pricing
View Details