Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Bone morphogenetic protein 4 (BMP4)

This Recombinant Bovine Bone morphogenetic protein 4 (BMP4) spans the amino acid sequence from region 294-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q2KJH1

Expression Region

294-409aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC317471 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27133156 3x 1.0 µg DNA

LOC317471 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Cdk5 (phospho Tyr15) rabbit pAb
ES4438-01 50 µL

Cdk5 (phospho Tyr15) rabbit pAb

Sign In for Pricing
View Details
Cdk5 (phospho Tyr15) rabbit pAb
ES4438-02 100 µL

Cdk5 (phospho Tyr15) rabbit pAb

Sign In for Pricing
View Details
NUDC Antibody
A30128-100UL 100 µL

NUDC Antibody

Sign In for Pricing
View Details
Bpnt1 (NM_011794) Mouse Tagged Lenti ORF Clone
MR204360L3 10 µg

Bpnt1 (NM_011794) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ipo5 siRNA Oligos set (Mouse)
25031174 3x 5 nmol

Ipo5 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details