Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C chemokine receptor type 6 (CCR6), partial

This Recombinant Human C-C chemokine receptor type 6 (CCR6), partial spans the amino acid sequence from region 1-47aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chemokine receptor-like 3 (CKR-L3) (DRY6) (G-protein coupled receptor 29) (GPR-CY4) (GPRCY4) (LARC receptor)

UniProt

P51684

Expression Region

1-47aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYE8P-set siRNA/shRNA/RNAi Lentivector (Human)
45258091 4x 500 ng

SPDYE8P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Lentiviral human DLX3 sgRNA gene knockout kit - Lentiviral human DLX3 sgRNA gene knockout kit (100)
GTR15359218 1 Vial

Lentiviral human DLX3 sgRNA gene knockout kit - Lentiviral human DLX3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human MTFR1L sgRNA gene knockout kit - Lentiviral human MTFR1L sgRNA gene knockout kit (25)
GTR15376170 1 Vial

Lentiviral human MTFR1L sgRNA gene knockout kit - Lentiviral human MTFR1L sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit Polyclonal GAS2L3 Antibody [DyLight 650]
NBP2-30359C 0.1 mL

Rabbit Polyclonal GAS2L3 Antibody [DyLight 650]

Sign In for Pricing
View Details
Anti-CCR7 Antibody , HRP Conjugate
A00390-2-HRP 100 µg/Vial

Anti-CCR7 Antibody , HRP Conjugate

Sign In for Pricing
View Details
FUS Antibody
CSB-PA229936-01 50 μL

FUS Antibody

Sign In for Pricing
View Details