Recombinant Human C-C chemokine receptor type 7 (CCR7), partial
This Recombinant Human C-C chemokine receptor type 7 (CCR7), partial spans the amino acid sequence from region 332-378aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BLR2 (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor)
UniProt
P32248
Expression Region
332-378aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
KFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H09332-2 20 µg
HURP (DLGAP5) (NM_014750) Human Over-expression Lysate
Sign In for Pricing
View Details 
![ELF4 Mouse Monoclonal Antibody [Clone ID: LBI4D5]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NB200-165AF405 0.1 mL
Goat Polyclonal SOD2/Mn-SOD Antibody [Alexa Fluor 405]
Sign In for Pricing
View Details