Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitronectin (VTN)

This Recombinant Human Vitronectin (VTN) spans the amino acid sequence from region 20-478aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S-protein (Serum-spreading factor) (V75)

UniProt

P04004

Expression Region

20-478aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human TSC2 Polyclonal Antibody
PHE71801 100 μg

Anti-Human TSC2 Polyclonal Antibody

Sign In for Pricing
View Details
SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 405)
MBS6192791-01 0.1 mL

SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 405)

Sign In for Pricing
View Details
SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 405)
MBS6192791-02 5x 0.1 mL

SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 405)

Sign In for Pricing
View Details
CSF1R Conjugated Antibody
MBS9442408-01 0.1 mL (Biotin)

CSF1R Conjugated Antibody

Sign In for Pricing
View Details
CSF1R Conjugated Antibody
MBS9442408-02 0.1 mL (AF350)

CSF1R Conjugated Antibody

Sign In for Pricing
View Details
CSF1R Conjugated Antibody
MBS9442408-03 0.1 mL (AF405)

CSF1R Conjugated Antibody

Sign In for Pricing
View Details