Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitronectin (VTN)

This Recombinant Human Vitronectin (VTN) spans the amino acid sequence from region 20-478aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S-protein (Serum-spreading factor) (V75)

UniProt

P04004

Expression Region

20-478aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated
orb1785038-01 20 µg

Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated
orb1785038-02 100 µg

Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated
orb1785038-03 1 mg

Recombinant Human Desmoglein-3 (DSG3), partial, Biotinylated

Sign In for Pricing
View Details
Theobromine
C08498-50mg 50 mg

Theobromine

Sign In for Pricing
View Details
PTK2B Rabbit Polyclonal Antibody (FITC)
orb2139183 100 µL

PTK2B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Complement C1q subcomponent subunit A ELISA Kit
MBS763220-01 48 Well

Mouse Complement C1q subcomponent subunit A ELISA Kit

Sign In for Pricing
View Details