Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Parathyroid hormone (PTH)

This Recombinant Macaca fascicularis Parathyroid hormone (PTH) spans the amino acid sequence from region 32-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parathyrin

UniProt

Q9XT35

Expression Region

32-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene
SGC56800-01 250 mg

2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene

Sign In for Pricing
View Details
2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene
SGC56800-02 2.5 g

2-Bromo-1,3-difluoro-5- (trifluoromethoxy) benzene

Sign In for Pricing
View Details
JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (AP) discontinued
J0904-AP 200 µL

JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (AP) discontinued

Sign In for Pricing
View Details
Adat1 Rat shRNA Plasmid (Locus ID 690810)
TR708087 1 Kit

Adat1 Rat shRNA Plasmid (Locus ID 690810)

Sign In for Pricing
View Details
C19orf38 Protein Vector (Human) (pPB-C-His)
PV065993 500 ng

C19orf38 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human HSD17B12 Protein, N-His
orb2832188-01 20 µg

Recombinant Human HSD17B12 Protein, N-His

Sign In for Pricing
View Details