Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme C (Gzmc)

This Recombinant Mouse Granzyme C (Gzmc) spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B10 (Cytotoxic cell protease 2) (CCP2)

UniProt

P08882

Expression Region

21-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gne sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
22317116 3x 1.0 µg

Gne sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PKNOX2 Antibody
E38PA2747 100 µL

PKNOX2 Antibody

Sign In for Pricing
View Details
KCNN4 (Potassium Intermediate/Small conductance Calcium-Activated Channel, Subfamily N, Member 4, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4)
247827 50 µg

KCNN4 (Potassium Intermediate/Small conductance Calcium-Activated Channel, Subfamily N, Member 4, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4)

Sign In for Pricing
View Details
Mouse IL-20 ELISA Kit (Colorimetric)
NBP3-06778 1 Kit

Mouse IL-20 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
100mL G418 Sulphate liquid 50 m
30-234-CI 1 Each

100mL G418 Sulphate liquid 50 m

Sign In for Pricing
View Details
CD45 (35-Z6)
sc-1178 200 µg/mL

CD45 (35-Z6)

Sign In for Pricing
View Details