Recombinant Pig Fatty acid-binding protein, heart (FABP3)
This Recombinant Pig Fatty acid-binding protein, heart (FABP3) spans the amino acid sequence from region 2-133aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fatty acid-binding protein 3 (Heart-type fatty acid-binding protein) (H-FABP)
UniProt
O02772
Expression Region
2-133aa
Tag
N-terminal 10xHis and C-terminal myc-tagged
Source
E.coli
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience; Cardiovascular Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VDAFAGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEVNGDTIIIKTQSTFKSTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWNGQETTLVRELVDGKLILTLTHGSAVCTRTYEKEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKN49398 96 Tests
Human Homing Associated Cell Adhesion Molecule (HCAM) ELISA Kit
Sign In for Pricing
View Details 
MBS1000252-01 0.02 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 LexA repressor (lexA)
Sign In for Pricing
View Details MBS1000252-02 0.1 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 LexA repressor (lexA)
Sign In for Pricing
View Details MBS1000252-03 0.02 mg (Yeast)
Recombinant Vibrio cholerae serotype O1 LexA repressor (lexA)
Sign In for Pricing
View Details MBS1000252-04 0.1 mg (Yeast)
Recombinant Vibrio cholerae serotype O1 LexA repressor (lexA)
Sign In for Pricing
View Details