Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia rickettsii Protein p34 (p34), partial

This Recombinant Rickettsia rickettsii Protein p34 (p34), partial spans the amino acid sequence from region 192-301aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P21559

Expression Region

192-301aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia rickettsii (strain Sheila Smith)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSSYSLFKKAFKNLVDHELPEQDRQKIISIVNNHLGAKGMHEMKTRYAGQKAFIQCHLEMDGNMSLYNAHKISDEIAFEILQEFPEAEIIIHQDPFGIEEHVKYREYIVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDN3 Antibody
E311601 200 µL

EDN3 Antibody

Sign In for Pricing
View Details
Anti-Human CD112/Nectin-2/PVRL2 Nanobody (SAA2116)
RHJ32502 100 μg

Anti-Human CD112/Nectin-2/PVRL2 Nanobody (SAA2116)

Sign In for Pricing
View Details
Human Monoclonal VEGF Antibody (Domantis patent anti-VEGF) [Biotin]
NBP3-27976B 0.1 mL

Human Monoclonal VEGF Antibody (Domantis patent anti-VEGF) [Biotin]

Sign In for Pricing
View Details
Tmed1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4575905 3x 1.0 µg

Tmed1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
DSPC Liposomes
PN-0002-2ML 2mL

DSPC Liposomes

Sign In for Pricing
View Details
Mouse Pparγc1Β (Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 beta) ELISA Kit
FY-EM5590 96 Well

Mouse Pparγc1Β (Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 beta) ELISA Kit

Sign In for Pricing
View Details