Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

This Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P04537

Expression Region

1-137aa

Tag

N-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human REG3G Protein, His Tag
KMH1637 50 µg

Recombinant Human REG3G Protein, His Tag

Sign In for Pricing
View Details
Lentiviral mouse Mapkap1 shRNA (UAS) - Lentiviral mouse Mapkap1 shRNA (UAS, RFP) (100)
GTR15200544 1 Vial

Lentiviral mouse Mapkap1 shRNA (UAS) - Lentiviral mouse Mapkap1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SSX9 Protein Vector (Mouse) (pPM-C-His)
PV234277 500 ng

SSX9 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
2-Chloro-N- (1-phenylbutyl) acetamide
QBA02334-01 250 mg

2-Chloro-N- (1-phenylbutyl) acetamide

Sign In for Pricing
View Details
2-Chloro-N- (1-phenylbutyl) acetamide
QBA02334-02 2.5 g

2-Chloro-N- (1-phenylbutyl) acetamide

Sign In for Pricing
View Details
Adgre1 Mouse Gene Knockout Kit (CRISPR)
KN505209 1 Kit

Adgre1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details