Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-16 (MUC16), partial

This Recombinant Human Mucin-16 (MUC16), partial spans the amino acid sequence from region 12660-12923aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ovarian cancer-related tumor marker CA125 (CA-125) (Ovarian carcinoma antigen CA125)

UniProt

Q8WXI7

Expression Region

12660-12923aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1259 Protein Vector (Rat) (pPB-N-His)
PV287579 500 ng

Olr1259 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rat FDFT1 shRNA Plasmid
abx985600-01 150 µg

Rat FDFT1 shRNA Plasmid

Sign In for Pricing
View Details
Rat FDFT1 shRNA Plasmid
abx985600-02 300 µg

Rat FDFT1 shRNA Plasmid

Sign In for Pricing
View Details
ISM2 Rabbit Polyclonal Antibody
BT-AP10687-01 20 µL

ISM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ISM2 Rabbit Polyclonal Antibody
BT-AP10687-02 50 µL

ISM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ISM2 Rabbit Polyclonal Antibody
BT-AP10687-03 100 µL

ISM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details