Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial
This Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial spans the amino acid sequence from region 774-914aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Peptidoglycan TGase (Penicillin-sensitive transpeptidase) (DD-transpeptidase)
UniProt
P39793
Expression Region
774-914aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Bacillus subtilis (strain 168)
Field of Research
Epigenetics, Non-Animal
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
49401064 1.0 µg DNA
UTS2R Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MPX2006K Each
Magic™ Membrane Protein SARS2 S Mutation (Q52R, ΔH69/V70, ΔY144, E484K, Q677H, F888L, D614G) Protein (Surface glycoprotein) RepoRoom Temperatureer Virus PaRoom Temperatureicles
Sign In for Pricing
View Details 
RC221983L3V 200 µL
LUZP2 (NM_001009909) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 