Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial

This Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial spans the amino acid sequence from region 774-914aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidoglycan TGase (Penicillin-sensitive transpeptidase) (DD-transpeptidase)

UniProt

P39793

Expression Region

774-914aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDEKTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSNNQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Testosterone Benzoate
467239-01 50 mg

Testosterone Benzoate

Sign In for Pricing
View Details
Testosterone Benzoate
467239-02 100 mg

Testosterone Benzoate

Sign In for Pricing
View Details
HEAT hydrochloride
sc-203996 10 mg

HEAT hydrochloride

Sign In for Pricing
View Details
Rat USP4 shRNA Plasmid
abx988470-01 150 µg

Rat USP4 shRNA Plasmid

Sign In for Pricing
View Details
Rat USP4 shRNA Plasmid
abx988470-02 300 µg

Rat USP4 shRNA Plasmid

Sign In for Pricing
View Details
Fexaramine (Standard)
HY-10912R-01 5 mg

Fexaramine (Standard)

Sign In for Pricing
View Details