Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 protein E4 (E4)

This Recombinant Human papillomavirus 11 protein E4 (E4) spans the amino acid sequence from region 1-90aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P04016

Expression Region

1-90aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human papillomavirus 11

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADDSALYEKYPLLNLLHTPPHRPPPLQCPPAPRKTACRRRLGSEHVDRPLTTPCVWPTSDPWTVQSTTSSLTITTSTKEGTTVTVQLRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3B Rabbit mAb (AMR12084N)
AMR12084N-01 50 µL

EIF3B Rabbit mAb (AMR12084N)

Sign In for Pricing
View Details
EIF3B Rabbit mAb (AMR12084N)
AMR12084N-02 100 µL

EIF3B Rabbit mAb (AMR12084N)

Sign In for Pricing
View Details
EIF3B Rabbit mAb (AMR12084N)
AMR12084N-03 200 µL

EIF3B Rabbit mAb (AMR12084N)

Sign In for Pricing
View Details
Olr196 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7242405 3x 1.0 µg

Olr196 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Polyclonal Sheep anti-human PTEN
hAP-5422 50 µg

Polyclonal Sheep anti-human PTEN

Sign In for Pricing
View Details
1,2,3-Tribromo-5-nitrobenzene
sc-473971 500 mg

1,2,3-Tribromo-5-nitrobenzene

Sign In for Pricing
View Details