Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Protein E7 (E7)

This Recombinant Human papillomavirus 11 Protein E7 (E7) spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P04020

Expression Region

1-98aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human papillomavirus 11

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2, ID (MSH2, DNA mismatch repair protein Msh2, MutS protein homolog 2) (MaxLight 490)
MBS6322489-01 0.1 mL

MSH2, ID (MSH2, DNA mismatch repair protein Msh2, MutS protein homolog 2) (MaxLight 490)

Sign In for Pricing
View Details
MSH2, ID (MSH2, DNA mismatch repair protein Msh2, MutS protein homolog 2) (MaxLight 490)
MBS6322489-02 5x 0.1 mL

MSH2, ID (MSH2, DNA mismatch repair protein Msh2, MutS protein homolog 2) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit RbBP7 IHC Antibody
orb1518552-01 10 µL

Rabbit RbBP7 IHC Antibody

Sign In for Pricing
View Details
Rabbit RbBP7 IHC Antibody
orb1518552-02 100 µL

Rabbit RbBP7 IHC Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CRMP-3 Polyclonal Antibody
PA87279HU-01 50 µg

Rabbit Anti-Human CRMP-3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CRMP-3 Polyclonal Antibody
PA87279HU-02 100 µg

Rabbit Anti-Human CRMP-3 Polyclonal Antibody

Sign In for Pricing
View Details