Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Pancreatic beta cell growth factor (INGAP)

This Recombinant Mesocricetus auratus Pancreatic beta cell growth factor (INGAP) spans the amino acid sequence from region 27-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Islet neogenesis-associated protein

UniProt

Q92778

Expression Region

27-175aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EESQKKLPSSRITCPQGSVAYGSYCYSLILIPQTWSNAELSCQMHFSGHLAFLLSTGEITFVSSLVKNSLTAYQYIWIGLHDPSHGTLPNGSGWKWSSSNVLTFYNWERNPSIAADRGYCAVLSQKSGFQKWRDFNCENELPYICKFKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADK ELISA Kit (Human)
OKCD00681-96W 96 Well

ADK ELISA Kit (Human)

Sign In for Pricing
View Details
Lagodeoxycholic Acid
MBS3920459-01 10 mg

Lagodeoxycholic Acid

Sign In for Pricing
View Details
Lagodeoxycholic Acid
MBS3920459-02 5x 10 mg

Lagodeoxycholic Acid

Sign In for Pricing
View Details
TMEM147 293 Cell Lysate
405158 0.1 mg

TMEM147 293 Cell Lysate

Sign In for Pricing
View Details
RPL36AP34 3'UTR Luciferase Stable Cell Line
TU021498 1.0 mL

RPL36AP34 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SEMA3B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV714871 1.0 µg DNA

SEMA3B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details