Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat High mobility group protein B1 (Hmgb1)

This Recombinant Rat High mobility group protein B1 (Hmgb1) spans the amino acid sequence from region 2-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High mobility group protein 1 (HMG-1)

UniProt

P63159

Expression Region

2-215aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)
TRV-0061988-01 20 µL

Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)

Sign In for Pricing
View Details
Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)
TRV-0061988-02 100 µL

Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)

Sign In for Pricing
View Details
Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)
TRV-0061988-03 200 µL

Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)

Sign In for Pricing
View Details
Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)
TRV-0061988-04 1 mL

Monoclonal Antibody to Monokine Induced By Interferon Gamma (MIg)

Sign In for Pricing
View Details
PTP4AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1754206 1.0 µg DNA

PTP4AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human EMD sgRNA gene knockout kit - Lentiviral human EMD sgRNA gene knockout kit (25)
GTR15360144 1 Vial

Lentiviral human EMD sgRNA gene knockout kit - Lentiviral human EMD sgRNA gene knockout kit (25)

Sign In for Pricing
View Details