Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Homeobox protein Meis1 (MEIS1), partial

This Recombinant Human Homeobox protein Meis1 (MEIS1), partial spans the amino acid sequence from region 180-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

O00470

Expression Region

180-320aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Clk3 shRNA (UAS) - Lentiviral mouseClk3 shRNA (UAS, GFP) (25)
GTR15213536 1 Vial

Lentiviral mouse Clk3 shRNA (UAS) - Lentiviral mouseClk3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FGD3 (ZFYVE5, FYVE, RhoGEF and PH Domain-containing Protein 3, Zinc Finger FYVE Domain-containing Protein 5, FLJ00004, MGC117260) (MaxLight 490)
126759-ML490 100 µL

FGD3 (ZFYVE5, FYVE, RhoGEF and PH Domain-containing Protein 3, Zinc Finger FYVE Domain-containing Protein 5, FLJ00004, MGC117260) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Mouse CD143/ACE Protein, N-His
E55P6702 50 µg

Recombinant Mouse CD143/ACE Protein, N-His

Sign In for Pricing
View Details
Recombinant Rhesus Macaque MACROD1 Protein, His (Fc)-Avi-tagged
MACROD1-2437R 50 µg

Recombinant Rhesus Macaque MACROD1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ZNF583 siRNA Oligos set (Human)
51639171 3x 5 nmol

ZNF583 siRNA Oligos set (Human)

Sign In for Pricing
View Details
GALNT2 Antibody
OC-911-01 50 μL

GALNT2 Antibody

Sign In for Pricing
View Details