Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Phospholipase A2 group XV (PLA2G15)

This Recombinant Dog Phospholipase A2 group XV (PLA2G15) spans the amino acid sequence from region 32-408aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-O-acylceramide synthase (ACS) (LCAT-like lysophospholipase) (LLPL) (Lysophospholipase 3) (Lysosomal phospholipase A2) (LPLA2)

UniProt

Q6XPZ3

Expression Region

32-408aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Standard MTP (HxD) 5x5=25 plates 45mm, 236x450x135mm
TE27484 1 Piece

Standard MTP (HxD) 5x5=25 plates 45mm, 236x450x135mm

Sign In for Pricing
View Details
FARSA Antibody Blocking peptide
orb1446342 500 µg

FARSA Antibody Blocking peptide

Sign In for Pricing
View Details
PLV3-U6-KAT8 (human) -shRNA2-Puro
BZ51641 1 Vial

PLV3-U6-KAT8 (human) -shRNA2-Puro

Sign In for Pricing
View Details
ZUFSP, NT (ZUFSP, C6orf113, Zinc finger with UFM1-specific peptidase domain protein) (APC) discontinued
044425-APC 200 µL

ZUFSP, NT (ZUFSP, C6orf113, Zinc finger with UFM1-specific peptidase domain protein) (APC) discontinued

Sign In for Pricing
View Details
Anti-VEGF
MBS483045-01 0.1 mg

Anti-VEGF

Sign In for Pricing
View Details
Anti-VEGF
MBS483045-02 5x 0.1 mg

Anti-VEGF

Sign In for Pricing
View Details